HPA058859

antibody from Atlas Antibodies

Targeting: SLC32A1 bA122O1.1, VGAT, VIAAT

Antibody data

Submit

Validation data

Product number: HPA058859 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA058859, RRID:AB_2683836
Product name: Anti-VGAT
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHC DDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGD IHYQRGSGAPLPPSGSKDQVG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC32A1 protein structure - HPA058859 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-VGAT antibody. Corresponding VGAT RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, eye, retina and lymph node using Anti-VGAT antibody HPA058859 (A) shows similar protein distribution across tissues to independent antibody HPA059985 (B).
Antibody #2 product nr: HPA059985
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human eye, retina using Anti-VGAT antibody HPA058859.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-VGAT antibody HPA058859.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-VGAT antibody HPA058859.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human eye, retina using Anti-VGAT antibody HPA058859.
Sample type: HUMAN