Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051594-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051594-A01, RRID:AB_535272
- Product name
- NAG polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant NAG.
- Antigen sequence
LEQITAVTTVNDSNCDQELLSLLLDAKLLVKCVST
PFYPRIVDHLLASLQQGRWDAEELGRHLREAGHEA
EAGSLLLAVRGTHQAFRTFSTALRAAQHWV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Neuroblastoma amplified sequence gene is associated with a novel short stature syndrome characterised by optic nerve atrophy and Pelger-Huët anomaly.
Maksimova N, Hara K, Nikolaeva I, Chun-Feng T, Usui T, Takagi M, Nishihira Y, Miyashita A, Fujiwara H, Oyama T, Nogovicina A, Sukhomyasova A, Potapova S, Kuwano R, Takahashi H, Nishizawa M, Onodera O
Journal of medical genetics 2010 Aug;47(8):538-48
Journal of medical genetics 2010 Aug;47(8):538-48
No comments: Submit comment
No validations: Submit validation data