Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079677-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079677-M01, RRID:AB_464275
- Product name
- SMC6L1 monoclonal antibody (M01), clone 2E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMC6L1.
- Antigen sequence
MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDEC
KGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSN
VNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSS
LKGFV- Isotype
- IgG
- Antibody clone number
- 2E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Smc5/6-mediated regulation of replication progression contributes to chromosome assembly during mitosis in human cells.
Gallego-Paez LM, Tanaka H, Bando M, Takahashi M, Nozaki N, Nakato R, Shirahige K, Hirota T
Molecular biology of the cell 2014 Jan;25(2):302-17
Molecular biology of the cell 2014 Jan;25(2):302-17
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SMC6L1 monoclonal antibody (M01), clone 2E6 Western Blot analysis of SMC6L1 expression in HeLa ( Cat # L013V1 ).
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SMC6L1 monoclonal antibody (M01), clone 2E6. Western Blot analysis of SMC6 expression in A-431.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SMC6L1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SMC6L1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
