Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056141-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056141-M08, RRID:AB_1137350
- Product name
- PCDHA7 monoclonal antibody (M08), clone 1C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCDHA7.
- Antigen sequence
AESRPLDSRFPLEGASDADIGENALLTYRLSPNEY
FFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLL
TATDGGKPELTGTVQLLITVLDNNDNAPV- Isotype
- IgG
- Antibody clone number
- 1C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PCDHA7 expression in transfected 293T cell line by PCDHA7 monoclonal antibody (M08), clone 1C7.Lane 1: PCDHA7 transfected lysate (Predicted MW: 100.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PCDHA7 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol