Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007124-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007124-M03, RRID:AB_437070
- Product name
- TNF monoclonal antibody (M03), clone M1-C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TNF.
- Antigen sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSL
FSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLI
SPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWL
NRRANALLANGVELRDNQLVVPSEGLYLIYSQVLF
KGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKS
PCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSA
EINRPDYLDFAESGQVYFGIIAL- Isotype
- IgG
- Antibody clone number
- M1-C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inhibitory effects of epi-sesamin on endothelial protein C receptor shedding in vitro and in vivo.
Ku SK, Lee W, Yoo H, Han CK, Bae JS
Inflammation research : official journal of the European Histamine Research Society ... [et al.] 2013 Oct;62(10):895-902
Inflammation research : official journal of the European Histamine Research Society ... [et al.] 2013 Oct;62(10):895-902
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TNF monoclonal antibody (M03), clone S2. Western Blot analysis of TNF expression in rat liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TNF is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TNF on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol