H00001016-A01

CDH18 antibody from Abnova Corporation
CDH14, EY-CADHERIN
No application information provided.

Antibody data

Product number
H00001016-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001016-A01, RRID:AB_462942
Product name
CDH18 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00001016-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant CDH18.
Antigen sequence
DLLSHVTVGIRVLDVNDNPPELAREYDIIVCENSK
PGQVIHTISATDKDDFANGPRFNFFLDERLPVNPN
FTLKDNEDNTASILTRRRRFSRTVQDVYYLPIMIS
DGGIP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -