Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- SAB1402025 - Provider product page
- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Monoclonal Anti-GDF7 antibody produced in mouse
- Antibody type
- Monoclonal
- Antigen
- GDF7 (NP_878248, 204 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Description
- purified immunoglobulin
- Reactivity
- Human
- Antigen sequence
vgqrweafdvadamrrhrreprpprafclllrava
gp vpsplalrrlgfgwpggggsaaeeravlvvss
rtqrkesl freiraqaralgaalaseplp- Isotype
- IgG
- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data