Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023583-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023583-A01, RRID:AB_535334
- Product name
- SMUG1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SMUG1.
- Antigen sequence
PQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEEL
RLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTR
YCQGPKE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Uracil-DNA glycosylase in base excision repair and adaptive immunity: species differences between man and mouse.
Doseth B, Visnes T, Wallenius A, Ericsson I, Sarno A, Pettersen HS, Flatberg A, Catterall T, Slupphaug G, Krokan HE, Kavli B
The Journal of biological chemistry 2011 May 13;286(19):16669-80
The Journal of biological chemistry 2011 May 13;286(19):16669-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SMUG1 polyclonal antibody (A01), Lot # 060608JCS1 Western Blot analysis of SMUG1 expression in SJCRH30 ( Cat # L027V1 ).