Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023583-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023583-M07, RRID:AB_10890694
- Product name
- SMUG1 monoclonal antibody (M07), clone 4D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant SMUG1.
- Antigen sequence
MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEE
LRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVT
RYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVR
DWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQS
MGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSS
QL- Isotype
- IgG
- Antibody clone number
- 4D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SMUG1 expression in transfected 293T cell line by SMUG1 monoclonal antibody (M07), clone 4D5.Lane 1: SMUG1 transfected lysate (Predicted MW: 19.6 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SMUG1 monoclonal antibody (M07), clone 4D5. Western Blot analysis of SMUG1 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SMUG1 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol