WH0005097M1

PCDH1 antibody from Sigma-Aldrich
pc42
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0005097M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0005097M1, RRID:AB_1842858
Product name
Monoclonal Anti-PCDH1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0005097M1
Antibody type
Monoclonal
Antigen
PCDH1 (NP_002578, a.a. 62-170) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGA
PYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDP
CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTP
NFA* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -