Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005097-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005097-M01, RRID:AB_489918
- Product name
- PCDH1 monoclonal antibody (M01), clone 5D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCDH1.
- Antigen sequence
YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGA
PYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDP
CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTP
NFA- Isotype
- IgG
- Antibody clone number
- 5D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of PCDH1 as a novel susceptibility gene for bronchial hyperresponsiveness.
Koppelman GH, Meyers DA, Howard TD, Zheng SL, Hawkins GA, Ampleford EJ, Xu J, Koning H, Bruinenberg M, Nolte IM, van Diemen CC, Boezen HM, Timens W, Whittaker PA, Stine OC, Barton SJ, Holloway JW, Holgate ST, Graves PE, Martinez FD, van Oosterhout AJ, Bleecker ER, Postma DS
American journal of respiratory and critical care medicine 2009 Nov 15;180(10):929-35
American journal of respiratory and critical care medicine 2009 Nov 15;180(10):929-35
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCDH1 monoclonal antibody (M01), clone 5D5 Western Blot analysis of PCDH1 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PCDH1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PCDH1 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PCDH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol