Antibody data

Product number
H00005097-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005097-M01, RRID:AB_489918
Product name
PCDH1 monoclonal antibody (M01), clone 5D5
Provider product page
Abnova Corporation - H00005097-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PCDH1.
Antigen sequence
YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGA
PYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDP
CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTP
NFA
Isotype
IgG
Antibody clone number
5D5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -