HPA050538

PCDH1 antibody from Atlas Antibodies
pc42
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA050538
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA050538, RRID:AB_2681162
Product name
Anti-PCDH1
Provider product page
Atlas Antibodies - HPA050538
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TRVVYKVPEEQPPNTLIGSLAADYGFPDVGHLYKL
EVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQL
PGDPCILEFEVSITDLVQN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -