SAB2101738

PCDH1 antibody from Sigma-Aldrich
pc42
No application information provided.

Antibody data

Product number
SAB2101738
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2101738, RRID:AB_10604469
Product name
Anti-PCDH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2101738
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_002578.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLLLPSMLLALLLLLAPSPGHATRVVYKVPEEQPP
NTLIGSLAADYGFPD
Storage
-20C
Provider Type Product Number
- No reagents -