HPA030695

antibody from Atlas Antibodies

Targeting: RCN2 E6BP, ERC-55, ERC55, TCBP49

Antibody data

Submit

Validation data

Product number: HPA030695 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA030695, RRID:AB_2673574
Product name: Anti-RCN2
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VTWDEYNIQMYDRVIDFDENTALDDAEEESFRKLH LKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYM TEF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RCN2 protein structure - HPA030695 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human epididymis and pancreas tissues using Anti-RCN2 antibody. Corresponding RCN2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, epididymis, pancreas and testis using Anti-RCN2 antibody HPA030695 (A) shows similar protein distribution across tissues to independent antibody HPA030694 (B).
Antibody #2 product nr: HPA030694
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-RCN2 antibody HPA030695.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-RCN2 antibody HPA030695.
Sample type: HUMAN