Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404840 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and AT Hook Domain Containing (ZFAT) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFAT1 antibody: synthetic peptide directed towards the middle region of human ZFAT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
KHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYD
CHICE RKFKNELDRD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ZFAT expression in B and T lymphocytes and identification of ZFAT-regulated genes.
Koyanagi M, Nakabayashi K, Fujimoto T, Gu N, Baba I, Takashima Y, Doi K, Harada H, Kato N, Sasazuki T, Shirasawa S
Genomics 2008 May;91(5):451-7
Genomics 2008 May;91(5):451-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting