HPA035117

GKAP1 antibody from Atlas Antibodies
FKSG21, GKAP42
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA035117
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035117, RRID:AB_2674473
Product name
Anti-GKAP1
Provider product page
Atlas Antibodies - HPA035117
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILL
QVDESQSIKNELTIQVTSLHAALEQERSKVKVLQA
ELAKYQGGRKGKRNSESDQCR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -