HPA066173

antibody from Atlas Antibodies

Targeting: GKAP1 FKSG21, GKAP42

Antibody data

Submit

Validation data

Product number: HPA066173 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA066173, RRID:AB_2732740
Product name: Anti-GKAP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQR DEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAE NTSTQSKVMNK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GKAP1 protein structure - HPA066173 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using Anti-GKAP1 antibody. Corresponding GKAP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-GKAP1 antibody HPA066173 (A) shows similar protein distribution across tissues to independent antibody HPA035118 (B).
Antibody #2 product nr: HPA035118
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-GKAP1 antibody HPA066173.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-GKAP1 antibody HPA066173.
Sample type: HUMAN