Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010707 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010707, RRID:AB_1853922
- Product name
- Anti-MGST2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Leukotriene C4 is the major trigger of stress-induced oxidative DNA damage.
Dvash E, Har-Tal M, Barak S, Meir O, Rubinstein M
Nature communications 2015 Dec 11;6:10112
Nature communications 2015 Dec 11;6:10112
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN