HPA028550

CA6 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028550
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028550, RRID:AB_10600105
Product name
Anti-CA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028550
Antibody type
Polyclonal
Antigen
carbonic anhydrase VI recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRN
KTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQF
YL
Storage
-20C
Provider Type Product Number
- No reagents -