Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [15]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91129 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91129, RRID:AB_2665811
- Product name
- Anti-CHAT
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACC
NQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNED
ERLPPIGLLTSDGRSEWAEARTVLVKDSTN- Epitope
- Binds to an epitope located within the peptide sequence GLFSSYRLPGHTQDT as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3169
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and liver tissues using AMAb91129 antibody. Corresponding CHAT RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining or rat basal forebrain shows strong immunoreactivity in acetylcholine neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining or mouse basal forebrain shows strong positivity in acetylcholine neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows positivity in cholinergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining or rat septum shows strong immunoreactivity in acetylcholine neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining or mouse striatum shows strong positivity in acetylcholine neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining or rat striatum shows strong immunoreactivity in acetylcholine neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows absence of immunoreactivity (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of rat brain shows strong cytoplasmic positivity in acetylcholine neurons in the basal forebrain.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of rat brain shows strong cytoplasmic positivity in acetylcholine neurons in the medial septum.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse brain shows strong cytoplasmic positivity in acetylcholine neurons in the basal forebrain.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse basal forebrain shows strong positivity in acetylcholine neurons in the caudate putamen.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows positivity in cholinergic neural fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in a subset of cells in chorionic villi.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.