AMAb91130

antibody from Atlas Antibodies

Targeting: CHAT

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

AMAb91130

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb91130, RRID:AB_2665812

Product name

Anti-CHAT

Antibody type

Monoclonal

Reactivity

Human, Mouse, Rat

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACC
NQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNED
ERLPPIGLLTSDGRSEWAEARTVLVKDSTN


Epitope

Binds to an epitope located within the peptide sequence GLFSSYRLPGHTQDT as determined by overlapping synthetic peptides.

Isotype

IgG

Antibody clone number

CL3173

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of SK-MEL-30 cells using the Anti-CHAT monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Sample type

HUMAN

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human placenta and liver tissues using AMAb91130 antibody. Corresponding CHAT RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining or rat diagonal band of Broca shows strong immunoreactivity in acetylcholine neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining or mouse striatum shows strong immunoreactivity in acetylcholine neurons and fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows positivity in cholinergic fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining or rat striatum shows strong immunoreactivity in acetylcholine neurons, as well as positivity in neural fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining or mouse basal forebrain shows strong immunoreactivity in acetylcholine neurons and fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining or rat basal forebrain shows strong immunoreactivity in acetylcholine neurons and fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of rat brain shows strong positivity in acetylcholine neurons in the basal forebrain.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of rat brain shows strong positivity in acetylcholine neurons in the medial septum.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse brain shows strong positivity in acetylcholine neurons in the basal forebrain.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse basal forebrain shows strong positivity in acetylcholine neurons in the caudate putamen.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate positivity in cholinergic neural fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in a subset of cells in chorionic villi.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.