Antibody data
- Antibody Data
- Antigen structure
- References [42]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027161-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027161-M01, RRID:AB_565459
- Product name
- EIF2C2 monoclonal antibody (M01), clone 2E12-1C9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant EIF2C2.
- Antigen sequence
MPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQL
VVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNV
QRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVF
QQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHP
NRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKST
RFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACI
KLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKS
GNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRP
SHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSV
SIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSG
QSNGRDHQALAKAVQVHQDTLRTMYFA- Isotype
- IgG
- Antibody clone number
- 2E12-1C9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Derepression of MicroRNA-138 Contributes to Loss of the Human Articular Chondrocyte Phenotype.
MicroRNA miR-24-3p promotes porcine reproductive and respiratory syndrome virus replication through suppression of heme oxygenase-1 expression.
Small RNA sequence analysis of adenovirus VA RNA-derived miRNAs reveals an unexpected serotype-specific difference in structure and abundance.
Characterisation and comparison of lactating mouse and bovine mammary gland miRNomes.
Identification of axon-enriched microRNAs localized to growth cones of cortical neurons.
MicroRNA directly enhances mitochondrial translation during muscle differentiation.
NMDA receptor-dependent regulation of miRNA expression and association with Argonaute during LTP in vivo.
Loss of miR-125b-1 contributes to head and neck cancer development by dysregulating TACSTD2 and MAPK pathway.
The microRNA 424/503 cluster reduces CDC25A expression during cell cycle arrest imposed by transforming growth factor β in mammary epithelial cells.
Comprehensive analysis of microRNA (miRNA) targets in breast cancer cells.
Single modification at position 14 of siRNA strand abolishes its gene-silencing activity by decreasing both RISC loading and target degradation.
Negative regulation of Toll-like receptor 4 signaling by IL-10-dependent microRNA-146b.
Remodeling of Ago2-mRNA interactions upon cellular stress reflects miRNA complementarity and correlates with altered translation rates.
Activated platelets can deliver mRNA regulatory Ago2•microRNA complexes to endothelial cells via microparticles.
Increasing expression of microRNA 181 inhibits porcine reproductive and respiratory syndrome virus replication and has implications for controlling virus infection.
The mammalian TRIM-NHL protein TRIM71/LIN-41 is a repressor of mRNA function.
Direct conversion of fibroblasts to neurons by reprogramming PTB-regulated microRNA circuits.
The microRNA-342-5p fosters inflammatory macrophage activation through an Akt1- and microRNA-155-dependent pathway during atherosclerosis.
A pathogenic mechanism in Huntington's disease involves small CAG-repeated RNAs with neurotoxic activity.
siRNA has greatly elevated mismatch tolerance at 3'-UTR sites.
The p38/MK2-driven exchange between tristetraprolin and HuR regulates AU-rich element-dependent translation.
Generation of miRNA sponge constructs.
MicroRNA-155 promotes atherosclerosis by repressing Bcl6 in macrophages.
Regulation of cyclin T1 and HIV-1 Replication by microRNAs in resting CD4+ T lymphocytes.
MicroRNAs regulate p21(Waf1/Cip1) protein expression and the DNA damage response in human embryonic stem cells.
Regulation of human chondrocyte function through direct inhibition of cartilage master regulator SOX9 by microRNA-145 (miRNA-145).
HIV-1 Gag co-opts a cellular complex containing DDX6, a helicase that facilitates capsid assembly.
Fragile X related protein 1 clusters with ribosomes and messenger RNAs at a subset of dendritic spines in the mouse hippocampus.
Characterization of extracellular circulating microRNA.
HuR-dependent loading of miRNA RISC to the mRNA encoding the Ras-related small GTPase RhoB controls its translation during UV-induced apoptosis.
Limiting Ago protein restricts RNAi and microRNA biogenesis during early development in Xenopus laevis.
Viral RNAi suppressor reversibly binds siRNA to outcompete Dicer and RISC via multiple turnover.
The QKI-6 RNA binding protein localizes with the MBP mRNAs in stress granules of glial cells.
P-body loss is concomitant with formation of a messenger RNA storage domain in mouse oocytes.
A dicer-independent miRNA biogenesis pathway that requires Ago catalysis.
Existence of a microRNA pathway in anucleate platelets.
A high throughput experimental approach to identify miRNA targets in human cells.
RNA-binding motif protein 4 translocates to cytoplasmic granules and suppresses translation via argonaute2 during muscle cell differentiation.
Dynamic interaction between P-bodies and transport ribonucleoprotein particles in dendrites of mature hippocampal neurons.
Reduced levels of Ago2 expression result in increased siRNA competition in mammalian cells.
Ribonuclease dicer cleaves triplet repeat hairpins into shorter repeats that silence specific targets.
Argonaute2 is essential for mammalian gastrulation and proper mesoderm formation.
Seidl CI, Martinez-Sanchez A, Murphy CL
Arthritis & rheumatology (Hoboken, N.J.) 2016 Feb;68(2):398-409
Arthritis & rheumatology (Hoboken, N.J.) 2016 Feb;68(2):398-409
MicroRNA miR-24-3p promotes porcine reproductive and respiratory syndrome virus replication through suppression of heme oxygenase-1 expression.
Xiao S, Wang X, Ni H, Li N, Zhang A, Liu H, Pu F, Xu L, Gao J, Zhao Q, Mu Y, Wang C, Sun Y, Du T, Xu X, Zhang G, Hiscox JA, Goodfellow IG, Zhou EM
Journal of virology 2015 Apr;89(8):4494-503
Journal of virology 2015 Apr;89(8):4494-503
Small RNA sequence analysis of adenovirus VA RNA-derived miRNAs reveals an unexpected serotype-specific difference in structure and abundance.
Kamel W, Segerman B, Punga T, Akusjärvi G
PloS one 2014;9(8):e105746
PloS one 2014;9(8):e105746
Characterisation and comparison of lactating mouse and bovine mammary gland miRNomes.
Le Guillou S, Marthey S, Laloë D, Laubier J, Mobuchon L, Leroux C, Le Provost F
PloS one 2014;9(3):e91938
PloS one 2014;9(3):e91938
Identification of axon-enriched microRNAs localized to growth cones of cortical neurons.
Sasaki Y, Gross C, Xing L, Goshima Y, Bassell GJ
Developmental neurobiology 2014 Mar;74(3):397-406
Developmental neurobiology 2014 Mar;74(3):397-406
MicroRNA directly enhances mitochondrial translation during muscle differentiation.
Zhang X, Zuo X, Yang B, Li Z, Xue Y, Zhou Y, Huang J, Zhao X, Zhou J, Yan Y, Zhang H, Guo P, Sun H, Guo L, Zhang Y, Fu XD
Cell 2014 Jul 31;158(3):607-19
Cell 2014 Jul 31;158(3):607-19
NMDA receptor-dependent regulation of miRNA expression and association with Argonaute during LTP in vivo.
Pai B, Siripornmongcolchai T, Berentsen B, Pakzad A, Vieuille C, Pallesen S, Pajak M, Simpson TI, Armstrong JD, Wibrand K, Bramham CR
Frontiers in cellular neuroscience 2014 Jan 13;7:285
Frontiers in cellular neuroscience 2014 Jan 13;7:285
Loss of miR-125b-1 contributes to head and neck cancer development by dysregulating TACSTD2 and MAPK pathway.
Nakanishi H, Taccioli C, Palatini J, Fernandez-Cymering C, Cui R, Kim T, Volinia S, Croce CM
Oncogene 2014 Feb 6;33(6):702-12
Oncogene 2014 Feb 6;33(6):702-12
The microRNA 424/503 cluster reduces CDC25A expression during cell cycle arrest imposed by transforming growth factor β in mammary epithelial cells.
Llobet-Navas D, Rodriguez-Barrueco R, de la Iglesia-Vicente J, Olivan M, Castro V, Saucedo-Cuevas L, Marshall N, Putcha P, Castillo-Martin M, Bardot E, Ezhkova E, Iavarone A, Cordon-Cardo C, Silva JM
Molecular and cellular biology 2014 Dec 1;34(23):4216-31
Molecular and cellular biology 2014 Dec 1;34(23):4216-31
Comprehensive analysis of microRNA (miRNA) targets in breast cancer cells.
Fan M, Krutilina R, Sun J, Sethuraman A, Yang CH, Wu ZH, Yue J, Pfeffer LM
The Journal of biological chemistry 2013 Sep 20;288(38):27480-93
The Journal of biological chemistry 2013 Sep 20;288(38):27480-93
Single modification at position 14 of siRNA strand abolishes its gene-silencing activity by decreasing both RISC loading and target degradation.
Zheng J, Zhang L, Zhang J, Wang X, Ye K, Xi Z, Du Q, Liang Z
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 Oct;27(10):4017-26
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 Oct;27(10):4017-26
Negative regulation of Toll-like receptor 4 signaling by IL-10-dependent microRNA-146b.
Curtale G, Mirolo M, Renzi TA, Rossato M, Bazzoni F, Locati M
Proceedings of the National Academy of Sciences of the United States of America 2013 Jul 9;110(28):11499-504
Proceedings of the National Academy of Sciences of the United States of America 2013 Jul 9;110(28):11499-504
Remodeling of Ago2-mRNA interactions upon cellular stress reflects miRNA complementarity and correlates with altered translation rates.
Karginov FV, Hannon GJ
Genes & development 2013 Jul 15;27(14):1624-32
Genes & development 2013 Jul 15;27(14):1624-32
Activated platelets can deliver mRNA regulatory Ago2•microRNA complexes to endothelial cells via microparticles.
Laffont B, Corduan A, Plé H, Duchez AC, Cloutier N, Boilard E, Provost P
Blood 2013 Jul 11;122(2):253-61
Blood 2013 Jul 11;122(2):253-61
Increasing expression of microRNA 181 inhibits porcine reproductive and respiratory syndrome virus replication and has implications for controlling virus infection.
Guo XK, Zhang Q, Gao L, Li N, Chen XX, Feng WH
Journal of virology 2013 Jan;87(2):1159-71
Journal of virology 2013 Jan;87(2):1159-71
The mammalian TRIM-NHL protein TRIM71/LIN-41 is a repressor of mRNA function.
Loedige I, Gaidatzis D, Sack R, Meister G, Filipowicz W
Nucleic acids research 2013 Jan 7;41(1):518-32
Nucleic acids research 2013 Jan 7;41(1):518-32
Direct conversion of fibroblasts to neurons by reprogramming PTB-regulated microRNA circuits.
Xue Y, Ouyang K, Huang J, Zhou Y, Ouyang H, Li H, Wang G, Wu Q, Wei C, Bi Y, Jiang L, Cai Z, Sun H, Zhang K, Zhang Y, Chen J, Fu XD
Cell 2013 Jan 17;152(1-2):82-96
Cell 2013 Jan 17;152(1-2):82-96
The microRNA-342-5p fosters inflammatory macrophage activation through an Akt1- and microRNA-155-dependent pathway during atherosclerosis.
Wei Y, Nazari-Jahantigh M, Chan L, Zhu M, Heyll K, Corbalán-Campos J, Hartmann P, Thiemann A, Weber C, Schober A
Circulation 2013 Apr 16;127(15):1609-19
Circulation 2013 Apr 16;127(15):1609-19
A pathogenic mechanism in Huntington's disease involves small CAG-repeated RNAs with neurotoxic activity.
Bañez-Coronel M, Porta S, Kagerbauer B, Mateu-Huertas E, Pantano L, Ferrer I, Guzmán M, Estivill X, Martí E
PLoS genetics 2012;8(2):e1002481
PLoS genetics 2012;8(2):e1002481
siRNA has greatly elevated mismatch tolerance at 3'-UTR sites.
Wei N, Zhang L, Huang H, Chen Y, Zheng J, Zhou X, Yi F, Du Q, Liang Z
PloS one 2012;7(11):e49309
PloS one 2012;7(11):e49309
The p38/MK2-driven exchange between tristetraprolin and HuR regulates AU-rich element-dependent translation.
Tiedje C, Ronkina N, Tehrani M, Dhamija S, Laass K, Holtmann H, Kotlyarov A, Gaestel M
PLoS genetics 2012 Sep;8(9):e1002977
PLoS genetics 2012 Sep;8(9):e1002977
Generation of miRNA sponge constructs.
Kluiver J, Slezak-Prochazka I, Smigielska-Czepiel K, Halsema N, Kroesen BJ, van den Berg A
Methods (San Diego, Calif.) 2012 Oct;58(2):113-7
Methods (San Diego, Calif.) 2012 Oct;58(2):113-7
MicroRNA-155 promotes atherosclerosis by repressing Bcl6 in macrophages.
Nazari-Jahantigh M, Wei Y, Noels H, Akhtar S, Zhou Z, Koenen RR, Heyll K, Gremse F, Kiessling F, Grommes J, Weber C, Schober A
The Journal of clinical investigation 2012 Nov;122(11):4190-202
The Journal of clinical investigation 2012 Nov;122(11):4190-202
Regulation of cyclin T1 and HIV-1 Replication by microRNAs in resting CD4+ T lymphocytes.
Chiang K, Sung TL, Rice AP
Journal of virology 2012 Mar;86(6):3244-52
Journal of virology 2012 Mar;86(6):3244-52
MicroRNAs regulate p21(Waf1/Cip1) protein expression and the DNA damage response in human embryonic stem cells.
Dolezalova D, Mraz M, Barta T, Plevova K, Vinarsky V, Holubcova Z, Jaros J, Dvorak P, Pospisilova S, Hampl A
Stem cells (Dayton, Ohio) 2012 Jul;30(7):1362-72
Stem cells (Dayton, Ohio) 2012 Jul;30(7):1362-72
Regulation of human chondrocyte function through direct inhibition of cartilage master regulator SOX9 by microRNA-145 (miRNA-145).
Martinez-Sanchez A, Dudek KA, Murphy CL
The Journal of biological chemistry 2012 Jan 6;287(2):916-24
The Journal of biological chemistry 2012 Jan 6;287(2):916-24
HIV-1 Gag co-opts a cellular complex containing DDX6, a helicase that facilitates capsid assembly.
Reed JC, Molter B, Geary CD, McNevin J, McElrath J, Giri S, Klein KC, Lingappa JR
The Journal of cell biology 2012 Aug 6;198(3):439-56
The Journal of cell biology 2012 Aug 6;198(3):439-56
Fragile X related protein 1 clusters with ribosomes and messenger RNAs at a subset of dendritic spines in the mouse hippocampus.
Cook D, Sanchez-Carbente Mdel R, Lachance C, Radzioch D, Tremblay S, Khandjian EW, DesGroseillers L, Murai KK
PloS one 2011;6(10):e26120
PloS one 2011;6(10):e26120
Characterization of extracellular circulating microRNA.
Turchinovich A, Weiz L, Langheinz A, Burwinkel B
Nucleic acids research 2011 Sep 1;39(16):7223-33
Nucleic acids research 2011 Sep 1;39(16):7223-33
HuR-dependent loading of miRNA RISC to the mRNA encoding the Ras-related small GTPase RhoB controls its translation during UV-induced apoptosis.
Glorian V, Maillot G, Polès S, Iacovoni JS, Favre G, Vagner S
Cell death and differentiation 2011 Nov;18(11):1692-701
Cell death and differentiation 2011 Nov;18(11):1692-701
Limiting Ago protein restricts RNAi and microRNA biogenesis during early development in Xenopus laevis.
Lund E, Sheets MD, Imboden SB, Dahlberg JE
Genes & development 2011 Jun 1;25(11):1121-31
Genes & development 2011 Jun 1;25(11):1121-31
Viral RNAi suppressor reversibly binds siRNA to outcompete Dicer and RISC via multiple turnover.
Rawlings RA, Krishnan V, Walter NG
Journal of molecular biology 2011 Apr 29;408(2):262-76
Journal of molecular biology 2011 Apr 29;408(2):262-76
The QKI-6 RNA binding protein localizes with the MBP mRNAs in stress granules of glial cells.
Wang Y, Lacroix G, Haines J, Doukhanine E, Almazan G, Richard S
PloS one 2010 Sep 17;5(9)
PloS one 2010 Sep 17;5(9)
P-body loss is concomitant with formation of a messenger RNA storage domain in mouse oocytes.
Flemr M, Ma J, Schultz RM, Svoboda P
Biology of reproduction 2010 May;82(5):1008-17
Biology of reproduction 2010 May;82(5):1008-17
A dicer-independent miRNA biogenesis pathway that requires Ago catalysis.
Cheloufi S, Dos Santos CO, Chong MM, Hannon GJ
Nature 2010 Jun 3;465(7298):584-9
Nature 2010 Jun 3;465(7298):584-9
Existence of a microRNA pathway in anucleate platelets.
Landry P, Plante I, Ouellet DL, Perron MP, Rousseau G, Provost P
Nature structural & molecular biology 2009 Sep;16(9):961-6
Nature structural & molecular biology 2009 Sep;16(9):961-6
A high throughput experimental approach to identify miRNA targets in human cells.
Tan LP, Seinen E, Duns G, de Jong D, Sibon OC, Poppema S, Kroesen BJ, Kok K, van den Berg A
Nucleic acids research 2009 Nov;37(20):e137
Nucleic acids research 2009 Nov;37(20):e137
RNA-binding motif protein 4 translocates to cytoplasmic granules and suppresses translation via argonaute2 during muscle cell differentiation.
Lin JC, Tarn WY
The Journal of biological chemistry 2009 Dec 11;284(50):34658-65
The Journal of biological chemistry 2009 Dec 11;284(50):34658-65
Dynamic interaction between P-bodies and transport ribonucleoprotein particles in dendrites of mature hippocampal neurons.
Zeitelhofer M, Karra D, Macchi P, Tolino M, Thomas S, Schwarz M, Kiebler M, Dahm R
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Jul 23;28(30):7555-62
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Jul 23;28(30):7555-62
Reduced levels of Ago2 expression result in increased siRNA competition in mammalian cells.
Vickers TA, Lima WF, Nichols JG, Crooke ST
Nucleic acids research 2007;35(19):6598-610
Nucleic acids research 2007;35(19):6598-610
Ribonuclease dicer cleaves triplet repeat hairpins into shorter repeats that silence specific targets.
Krol J, Fiszer A, Mykowska A, Sobczak K, de Mezer M, Krzyzosiak WJ
Molecular cell 2007 Feb 23;25(4):575-86
Molecular cell 2007 Feb 23;25(4):575-86
Argonaute2 is essential for mammalian gastrulation and proper mesoderm formation.
Alisch RS, Jin P, Epstein M, Caspary T, Warren ST
PLoS genetics 2007 Dec 28;3(12):e227
PLoS genetics 2007 Dec 28;3(12):e227
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EIF2C2 expression in transfected 293T cell line by EIF2C2 monoclonal antibody (M01), clone 2E12-1C9.Lane 1: EIF2C2 transfected lysate (Predicted MW: 42.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EIF2C2 monoclonal antibody (M01), clone 2E12-1C9. Western Blot analysis of EIF2C2 expression in MCF-7.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EIF2C2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to EIF2C2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to EIF2C2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol