Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010220-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010220-M03, RRID:AB_606287
- Product name
- GDF11 monoclonal antibody (M03), clone 1E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GDF11.
- Antigen sequence
ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQ
CEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSP
INMLYFNDKQQIIYGKIPGMVVDRCGCS- Isotype
- IgG
- Antibody clone number
- 1E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GDF11 monoclonal antibody (M03), clone 1E6 Western Blot analysis of GDF11 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GDF11 monoclonal antibody (M03), clone 1E6. Western Blot analysis of GDF11 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GDF11 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol