Explore
Validate
LearnAMAb91570
antibody from Atlas Antibodies
Targeting: CHEK2
bA444G7, CDS1, CHK2, HuCds1, PP1425, RAD53
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91570 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CHEK2
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPED
QEPEDQEPEEPTPAPWARLWALQDGFANLECVNDN
YWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIF
REVGPKNSYIAYIEDHSGNG- Epitope
- Binds to an epitope located within the peptide sequence QEPEEPTPAPWARLW as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL9440
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line HEL.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of MCF7 cells using the Anti-CHEK2 monoclonal antibody, showing specific staining in the nucleus in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and cerebral cortex tissues using AMAb91570 antibody. Corresponding CHEK2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis cancer, seminoma shows strong nuclear positivity.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human human embryonal carcinoma of testis shows strong nuclear positivity.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
