Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057819-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057819-A01, RRID:AB_714760
- Product name
- LSM2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LSM2.
- Antigen sequence
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQY
LNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYV
QLPADEVDTQLLQDAARKEALQQKQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Low-molecular-mass secretome profiling identifies C-C motif chemokine 5 as a potential plasma biomarker and therapeutic target for nasopharyngeal carcinoma.
Lin SJ, Chang KP, Hsu CW, Chi LM, Chien KY, Liang Y, Tsai MH, Lin YT, Yu JS
Journal of proteomics 2013 Dec 6;94:186-201
Journal of proteomics 2013 Dec 6;94:186-201
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LSM2 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of LSM2 expression in 293 ( Cat # L026V1 ).