Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064399-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064399-M01, RRID:AB_518852
- Product name
- HHIP monoclonal antibody (M01), clone 5D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HHIP.
- Antigen sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRM
MSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRL
ENKIFSVTNNTECGKLLEEIKCALCSPHSQ- Isotype
- IgG
- Antibody clone number
- 5D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Role of hedgehog signaling in malignant pleural mesothelioma.
Shi Y, Moura U, Opitz I, Soltermann A, Rehrauer H, Thies S, Weder W, Stahel RA, Felley-Bosco E
Clinical cancer research : an official journal of the American Association for Cancer Research 2012 Sep 1;18(17):4646-56
Clinical cancer research : an official journal of the American Association for Cancer Research 2012 Sep 1;18(17):4646-56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HHIP monoclonal antibody (M01), clone 5D11 Western Blot analysis of HHIP expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HHIP monoclonal antibody (M01), clone 5D11. Western Blot analysis of HHIP expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody (M01), clone 5D11.Lane 1: HHIP transfected lysate(78.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HHIP is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of HHIP transfected lysate using anti-HHIP monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HHIP MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
