Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004062-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004062-M01, RRID:AB_425531
- Product name
- LY6H monoclonal antibody (M01), clone 3E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant LY6H.
- Antigen sequence
LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDP
SSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINS
GILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLS
LGPALLWAGP- Isotype
- IgG
- Antibody clone number
- 3E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Quantitative profiling of brain lipid raft proteome in a mouse model of fragile X syndrome.
Kalinowska M, Castillo C, Francesconi A
PloS one 2015;10(4):e0121464
PloS one 2015;10(4):e0121464
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LY6H monoclonal antibody (M01), clone 3E10 Western Blot analysis of LY6H expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol