H00063935-B01P

PCIF1 antibody from Abnova Corporation
bA465L10.1, C20orf67, PPP1R121

Antibody data

Product number
H00063935-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00063935-B01P, RRID:AB_10721474
Product name
PCIF1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00063935-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PCIF1 protein.
Antigen sequence
MANENHGSPREEASLLSHSPGTSNQSQPCSPKPIR
LVQDLPEELVHAGWEKCWSRRENRPYYFNRFTNQS
LWEMPVLGQHDVISDPLGLNATPLPQDSSLVETPP
AENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQS
VPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVY
WDLDIQTNAVIKHRGPSEVLPPHPEVELLRSQLIL
KLRQHYRELCQQREGIEPPRESFNRWMLERKVVDK
GSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKF
REEAKRLLFKYAEAARRLIESRSASPDSRKVVKWN
VEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVS
AAAKDSVEGICSKIYHISLEYVKRIREKHLAILKE
NNISEEVEAPEVEPRLVYCYPVRLAVSAPPMPSVE
MHMENNVVCIRYKGEMVKVSRNYFSKLWLLYRYSC
IDDSAFERFLPRVWCLLRRYQMMFGVGLYEGTGLQ
GSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCS
AFPDTDGYFGSRGPCLDFAPLSGSFEANPPFCEEL
MDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPA
LTRMEQSRFKRHQLILPAFEHEYRSGSQHICKKEE
MHYKAVHNTAVLFLQNDPGFAKWAPTPERLQELSA
AYRQSGRSHSSGSSSSSSSEAKDRDSGREQGPSRE
PHPT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -