HPA029323

antibody from Atlas Antibodies

Targeting: MS4A4A CD20L1, MS4A4, MS4A7

Antibody data

Submit

Validation data

Product number: HPA029323 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029323, RRID:AB_10601866
Product name: Anti-MS4A4A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLN EV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MS4A4A protein structure - HPA029323 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA029323 antibody. Corresponding MS4A4A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows membranous positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows membranous positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
Sample type: HUMAN