HPA037779

antibody from Atlas Antibodies

Targeting: A1CF ACF, ACF64, ACF65, APOBEC1CF, ASP

Antibody data

Submit

Validation data

Product number: HPA037779 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA037779, RRID:AB_10670529
Product name: Anti-A1CF
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAI HPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGD GTMATAA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

A1CF protein structure - HPA037779 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and tonsil using Anti-A1CF antibody HPA037779 (A) shows similar protein distribution across tissues to independent antibody HPA044079 (B).
Antibody #2 product nr: HPA044079
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows moderate nuclear/cytoplasmic positivity in glandular cells.
Sample type: HUMAN