Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405249 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 335 (ZNF335) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF335 antibody: synthetic peptide directed towards the middle region of human ZNF335
- Description
- Affinity Purified
- Reactivity
- Human, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQ
LQHQG IEYDVITLAD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Components of the CCR4-NOT complex function as nuclear hormone receptor coactivators via association with the NRC-interacting Factor NIF-1.
Garapaty S, Mahajan MA, Samuels HH
The Journal of biological chemistry 2008 Mar 14;283(11):6806-16
The Journal of biological chemistry 2008 Mar 14;283(11):6806-16
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting