Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051327-M17 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051327-M17, RRID:AB_1574734
- Product name
- ERAF monoclonal antibody (M17), clone 3C9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ERAF.
- Antigen sequence
MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEE
DMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL
RQELNTLANPFLAKYRDFLKSHELPSHPPPSS- Isotype
- IgG
- Antibody clone number
- 3C9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Transgenic human alpha-hemoglobin stabilizing protein could partially relieve betaIVS-2-654-thalassemia syndrome in model mice.
Wang B, Fang Y, Guo X, Ren Z, Zhang J
Human gene therapy 2010 Feb;21(2):149-56
Human gene therapy 2010 Feb;21(2):149-56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ERAF is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol