Antibody data

Product number
H00051327-M17
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051327-M17, RRID:AB_1574734
Product name
ERAF monoclonal antibody (M17), clone 3C9
Provider product page
Abnova Corporation - H00051327-M17
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ERAF.
Antigen sequence
MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEE
DMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL
RQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Isotype
IgG
Antibody clone number
3C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -