Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001044-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001044-M01, RRID:AB_534812
- Product name
- CDX1 monoclonal antibody (M01), clone 2D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDX1.
- Antigen sequence
GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVV
YTDHQRLELEKEFHYSRYITIRRKSELAANLGLTE
RQVKIWFQNRRAKERKVNKK- Isotype
- IgG
- Antibody clone number
- 2D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Activation of the BMP4 pathway and early expression of CDX2 characterize non-specialized columnar metaplasia in a human model of Barrett's esophagus.
Castillo D, Puig S, Iglesias M, Seoane A, de Bolós C, Munitiz V, Parrilla P, Comerma L, Poulsom R, Krishnadath KK, Grande L, Pera M
Journal of gastrointestinal surgery : official journal of the Society for Surgery of the Alimentary Tract 2012 Feb;16(2):227-37; discussion 237
Journal of gastrointestinal surgery : official journal of the Society for Surgery of the Alimentary Tract 2012 Feb;16(2):227-37; discussion 237
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CDX1 monoclonal antibody (M01), clone 2D8. Western Blot analysis of CDX1 expression in human lung cancer.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CDX1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
