Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91125 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91125, RRID:AB_2665810
- Product name
- Anti-DAT
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSS
GDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDL
G- Epitope
- Binds to an epitope located within the peptide sequence ELPWIHCNNSWNSPN as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3123
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat striatum shows strong immunoreactivity in dopaminergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse striatum shows strong immunoreactivity in dopaminergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human caudate nucleus shows immunoreactivity in dopaminergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat cerebral cortex shows positivity in dopaminergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse cerebral cortex shows positivity in dopaminergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human substantia nigra shows moderate immunoreactivity in dopamine neurons and fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).