ABIN310638

CHIC1 antibody from antibodies-online
BRX
Western blot
Data presented on provider website

Antibody data

Product number
ABIN310638
Provider
antibodies-online
Product name
anti-Cysteine-Rich Hydrophobic Domain 1 (CHIC1) (N-Term) antibody
Provider product page
antibodies-online - ABIN310638
Antibody type
Polyclonal
Antigen
The immunogen for anti-CHIC1 antibody: synthetic peptide directed towards the N terminal of human CHIC1
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLT
GKVAP EEFKTSIGRV
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.