AV44893

CHIC1 antibody from MilliporeSigma / Merck KGaA
BRX
No application information provided.

Antibody data

Product number
AV44893
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CHIC1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV44893
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CHIC1 with an internal ID of P25971
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
PPRVVSEEHLRRYAPDPVLVRGAGHITVFGLSNKF
DTEFPSVLTGKVAPE
Storage
-20C