Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00065263-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00065263-M01, RRID:AB_566114
- Product name
- PYCRL monoclonal antibody (M01), clone 4F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PYCRL.
- Antigen sequence
KVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVL
QSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSV
AAGVSLSTLEELLPPNTRVLRVLPNLPCVV- Isotype
- IgG
- Antibody clone number
- 4F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Functional specialization in proline biosynthesis of melanoma.
De Ingeniis J, Ratnikov B, Richardson AD, Scott DA, Aza-Blanc P, De SK, Kazanov M, Pellecchia M, Ronai Z, Osterman AL, Smith JW
PloS one 2012;7(9):e45190
PloS one 2012;7(9):e45190
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PYCRL monoclonal antibody (M01), clone 4F11 Western Blot analysis of PYCRL expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PYCRL expression in transfected 293T cell line by PYCRL monoclonal antibody (M01), clone 4F11.Lane 1: PYCRL transfected lysate (Predicted MW: 28.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PYCRL is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PYCRL on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of PYCRL transfected lysate using anti-PYCRL monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PYCRL monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
