HPA007931

antibody from Atlas Antibodies

Targeting: ISYNA1 Ino1, INOS, IPS

Antibody data

Submit

Validation data

Product number: HPA007931 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA007931, RRID:AB_2667940
Product name: Anti-ISYNA1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPL QFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVV IKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTC EDSLLAAPIMLDLA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ISYNA1 protein structure - HPA007931 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and liver tissues using Anti-ISYNA1 antibody. Corresponding ISYNA1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, placenta and testis using Anti-ISYNA1 antibody HPA007931 (A) shows similar protein distribution across tissues to independent antibody HPA008232 (B).
Antibody #2 product nr: HPA008232
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ISYNA1 antibody HPA007931.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ISYNA1 antibody HPA007931.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta using Anti-ISYNA1 antibody HPA007931.
Sample type: HUMAN