Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014405 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014405, RRID:AB_1858606
- Product name
- Anti-UGT8
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIF
NSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTK
NCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVI
AHLLGVKYAVFSTGLWYPAEVGAPA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Ceramide galactosyltransferase (UGT8) is a molecular marker of breast cancer malignancy and lung metastases
Dzi\[ecedil]giel P, Owczarek T, Pla\[zgrave]uk E, Gomułkiewicz A, Majchrzak M, Podhorska-Okołów M, Driouch K, Lidereau R, Ugorski M
British Journal of Cancer 2010 July;103(4):524-531
British Journal of Cancer 2010 July;103(4):524-531
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in glial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong positivity in apical membrane of glandular cells, as well as moderate cytoplasmic immunoreactivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN