HPA035143

STAC antibody from Sigma-Aldrich
STAC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035143
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA035143, RRID:AB_10603892
Product name
Anti-STAC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA035143
Antibody type
Polyclonal
Antigen
SH3 and cysteine rich domain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNS
VFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTY
Storage
-20C
Provider Type Product Number
- No reagents -