Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB24266 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB24266, RRID:AB_11126316
- Product name
- TMEM144 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human TMEM144.
- Description
- Rabbit polyclonal antibody raised against recombinant TMEM144.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
CSMDTTPLITEHVINTTQDPCSWVDKLSTVHHRI
- Isotype
- IgG
- Vial size
- 100 μL
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data