H00009265-M01

CYTH3 antibody from Abnova Corporation
ARNO3, cytohesin-3, GRP1, PSCD3

Antibody data

Product number
H00009265-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009265-M01, RRID:AB_437091
Product name
PSCD3 monoclonal antibody (M01), clone 6D3-1A9
Provider product page
Abnova Corporation - H00009265-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant PSCD3.
Antigen sequence
MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDG
NDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTD
NCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPN
CFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRI
SAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRI
ANKK*
Isotype
IgG
Antibody clone number
6D3-1A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -