Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009265-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009265-M01, RRID:AB_437091
- Product name
- PSCD3 monoclonal antibody (M01), clone 6D3-1A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PSCD3.
- Antigen sequence
MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDG
NDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTD
NCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPN
CFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRI
SAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRI
ANKK*- Isotype
- IgG
- Antibody clone number
- 6D3-1A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PSCD3 monoclonal antibody (M01), clone 6D3-1A9 Western Blot analysis of PSCD3 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PSCD3 expression in transfected 293T cell line by PSCD3 monoclonal antibody (M01), clone 6D3-1A9.Lane 1: PSCD3 transfected lysate(46.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PSCD3 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PSCD3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol