HPA048186

antibody from Atlas Antibodies

Targeting: TKFC DAK, DKFZP586B1621, NET45

Antibody data

Submit

Validation data

Product number: HPA048186 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA048186, RRID:AB_2680305
Product name: Anti-TKFC
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAV KSAEAAAEATKNMEAGAGRASYISSARLEQPDPGA VAAAAILRAIL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TKFC protein structure - HPA048186 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and skeletal muscle tissues using Anti-TKFC antibody. Corresponding TKFC RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human duodenum, kidney, liver and skeletal muscle using Anti-TKFC antibody HPA048186 (A) shows similar protein distribution across tissues to independent antibody HPA039486 (B).
Antibody #2 product nr: HPA039486
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows cytoplasmic and nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-TKFC antibody HPA048186.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-TKFC antibody HPA048186.
Sample type: HUMAN