WH0051586M2

MED15 antibody from Sigma-Aldrich
Arc105, CAG7A, PCQAP, TIG-1, TNRC7
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0051586M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0051586M2, RRID:AB_1842896
Product name
Monoclonal Anti-PCQAP antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0051586M2
Antibody type
Monoclonal
Antigen
PCQAP (NP_056973, a.a. 1-89) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse
Antigen sequence
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHS
KSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIH
NKKSQASVSDPMNALQSL* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -