PAB28707

MED15 antibody from Abnova Corporation
Arc105, CAG7A, PCQAP, TIG-1, TNRC7

Antibody data

Product number
PAB28707
Provider
Abnova Corporation
Product name
MED15 polyclonal antibody
Provider product page
Abnova Corporation - PAB28707
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant MED15.
Antigen sequence
QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKT
RDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQ
SLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQ
PMSLSGQP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -