H00051586-M02

MED15 antibody from Abnova Corporation
Arc105, CAG7A, PCQAP, TIG-1, TNRC7

Antibody data

Product number
H00051586-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051586-M02, RRID:AB_530166
Product name
PCQAP monoclonal antibody (M02), clone 4A4
Provider product page
Abnova Corporation - H00051586-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PCQAP.
Antigen sequence
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHS
KSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIH
NKKSQASVSDPMNALQSL
Isotype
IgG
Antibody clone number
4A4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -