Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449880 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Adenylosuccinate Synthase Like 1 (ADSSL1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human ADSSL1
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAART
GLRICDLLSDFDEFS- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Molecular cloning and characterization of a novel muscle adenylosuccinate synthetase, AdSSL1, from human bone marrow stromal cells.
Sun H, Li N, Wang X, Chen T, Shi L, Zhang L, Wang J, Wan T, Cao X
Molecular and cellular biochemistry 2005 Jan;269(1-2):85-94
Molecular and cellular biochemistry 2005 Jan;269(1-2):85-94
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Muscle; WB Suggested Anti-ADSSL1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Muscle; ADSSL1 antibody - middle region (AP44855PU-N) in Human Muscle cells using Western Blot