Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079087-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079087-M06, RRID:AB_605924
- Product name
- ALG12 monoclonal antibody (M06), clone 5E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ALG12.
- Antigen sequence
NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVS
RFLQVNSAWRYDKREDVQPGTG- Isotype
- IgG
- Antibody clone number
- 5E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ALG12 monoclonal antibody (M06), clone 5E3 Western Blot analysis of ALG12 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ALG12 monoclonal antibody (M06), clone 5E3. Western Blot analysis of ALG12 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ALG12 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol