HPA037946

antibody from Atlas Antibodies

Targeting: RTKN2 bA531F24.1, Em:AC024597.2, FLJ39352, PLEKHK1

Antibody data

Submit

Validation data

Product number: HPA037946 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA037946, RRID:AB_10795398
Product name: Anti-RTKN2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GANVFDTDVVNVDKTITDICFENVTIFNEAGPDFQ IKVEVYSCCTEESSITNTPKKLAKKLKTSISKATG KKISSVLQEEDDEMCLLLSSA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RTKN2 protein structure - HPA037946 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, lung, lymph node and testis using Anti-RTKN2 antibody HPA037946 (A) shows similar protein distribution across tissues to independent antibody HPA038446 (B).
Antibody #2 product nr: HPA038446
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-RTKN2 antibody HPA037946.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-RTKN2 antibody HPA037946.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung using Anti-RTKN2 antibody HPA037946.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-RTKN2 antibody HPA037946.
Sample type: HUMAN