Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183156 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chloride Channel, Voltage-Sensitive 6 (CLCN6) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLCN6 antibody: synthetic peptide directed towards the C terminal of human CLCN6
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit
- Host
- Rabbit
- Antigen sequence
PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAG
VAAAF GAPIGGTLFS- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Multiple transcription start sites and alternative splicing in the methylenetetrahydrofolate reductase gene result in two enzyme isoforms.
Tran P, Leclerc D, Chan M, Pai A, Hiou-Tim F, Wu Q, Goyette P, Artigas C, Milos R, Rozen R
Mammalian genome : official journal of the International Mammalian Genome Society 2002 Sep;13(9):483-92
Mammalian genome : official journal of the International Mammalian Genome Society 2002 Sep;13(9):483-92
No comments: Submit comment
No validations: Submit validation data